Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lgals7 protein

This Mouse Lgals7 protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lgals7

UniProt

O54974

Expression Region

2-136aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-136aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP Ref Sol. Y6
EPY601 100 mL

EP Ref Sol. Y6

Sign In for Pricing
View Details
Shikimic acid 98%
S02520-01 100 mg

Shikimic acid 98%

Sign In for Pricing
View Details
Shikimic acid 98%
S02520-02 1000 mg

Shikimic acid 98%

Sign In for Pricing
View Details
Shikimic acid 98%
S02520-03 5000 mg

Shikimic acid 98%

Sign In for Pricing
View Details
P4HA1 Knockout HT29 Polyclonal Cells
ARG14621 1 Million

P4HA1 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral mouse Flywch1 shRNA (UAS) - Lentiviral mouse Flywch1 shRNA (UAS, GFP) plasmid
GTR15273766 1 Vial

Lentiviral mouse Flywch1 shRNA (UAS) - Lentiviral mouse Flywch1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details