Mouse Lgals7 protein
This Mouse Lgals7 protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Lgals7
UniProt
O54974
Expression Region
2-136aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-tag and expression region is 2-136aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15237529 1 Vial
Lentiviral mouse Pth1r shRNA (UAS) - Lentiviral mouse Pth1r shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 02015 00500 500 mL
Phosphoprus Oxychloride 98% Extrapure (2x 500ml)
Sign In for Pricing
View Details 
124652-FITC 100 µL
CD56 (Neural Cell Adhesion Molecule 1, N-CAM-1, NCAM-1, NCAM1, NCAM) (FITC)
Sign In for Pricing
View Details 
CK-bio-26632-01 48 Tests
Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
Sign In for Pricing
View Details CK-bio-26632-02 96 Tests
Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
Sign In for Pricing
View Details