Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2W protein

This Human UBE2W protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBE2W

UniProt

Q96B02

Expression Region

1-151aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldose 1-Epimerase (GALM) Antibody
abx233321 100 µg

Aldose 1-Epimerase (GALM) Antibody

Sign In for Pricing
View Details
Fkbp11-set siRNA/shRNA/RNAi Lentivector (Mouse)
20573094 4x 500 ng

Fkbp11-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Tubulin alpha-8 Antibody (OTI2G6) [PE/Cy5.5]
NBP2-74709PECY55 0.1 mL

Mouse Monoclonal Tubulin alpha-8 Antibody (OTI2G6) [PE/Cy5.5]

Sign In for Pricing
View Details
HIF-2 alpha/EPAS1 Antibody Blocking Peptide - (Dry Ice)
NB100-122PEP 0.1 mg

HIF-2 alpha/EPAS1 Antibody Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
DLGAP4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-12140R-BF488 100 µL

DLGAP4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
TMEM31 (NM_182541) Human Tagged ORF Clone
RG206932 10 µg

TMEM31 (NM_182541) Human Tagged ORF Clone

Sign In for Pricing
View Details