Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2W protein

This Human UBE2W protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBE2W

UniProt

Q96B02

Expression Region

1-151aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Human SEZ6 (C-9His-Avi)
CY131-01 20 µg

Biotinylated Human SEZ6 (C-9His-Avi)

Sign In for Pricing
View Details
Biotinylated Human SEZ6 (C-9His-Avi)
CY131-02 100 µg

Biotinylated Human SEZ6 (C-9His-Avi)

Sign In for Pricing
View Details
Rho-Related GTP-binding protein RhoE (RND3) Porcine ELISA Kit
G7703 96 Tests

Rho-Related GTP-binding protein RhoE (RND3) Porcine ELISA Kit

Sign In for Pricing
View Details
PerCP-Cy5.5 anti-human CD45RO
E16FHS0456-025 25 Tests

PerCP-Cy5.5 anti-human CD45RO

Sign In for Pricing
View Details
Multiplex Assay Kit for Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030275 96 Tests

Multiplex Assay Kit for Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
SEMA4B sgRNA CRISPR Lentivector (Human) (Target 2)
K2116603 1.0 µg DNA

SEMA4B sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details