Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCML4 protein

This Human SCML4 protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SCML4

UniProt

Q8N228

Expression Region

1-305aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPCQRTAWIGCDRQRTPPFHWREIKSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACIDCAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCGNVMHASASH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor, Acidic (FGFa)
MBS629555-01 0.05 mg

Fibroblast Growth Factor, Acidic (FGFa)

Sign In for Pricing
View Details
Fibroblast Growth Factor, Acidic (FGFa)
MBS629555-02 0.1 mg

Fibroblast Growth Factor, Acidic (FGFa)

Sign In for Pricing
View Details
Fibroblast Growth Factor, Acidic (FGFa)
MBS629555-03 5x 0.1 mg

Fibroblast Growth Factor, Acidic (FGFa)

Sign In for Pricing
View Details
KAP3 (D-10)
sc-374384 200 µg/mL

KAP3 (D-10)

Sign In for Pricing
View Details
Mouse Monoclonal CXCL14/BRAK Antibody (MM0213-12B24) [FITC]
NBP2-12224F 0.1 mL

Mouse Monoclonal CXCL14/BRAK Antibody (MM0213-12B24) [FITC]

Sign In for Pricing
View Details
KRT80 Protein Lysate (Human) with C-Ha Tag
26050031 100 µg

KRT80 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details