Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NMNAT3 protein

This Human NMNAT3 protein spans the amino acid sequence from region 1-215aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NMNAT3

UniProt

Q96T66

Expression Region

1-215aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbohydrate Sulfotransferase 1 (CHST1) ELISA Kit
YLA3471HU-01 48 Tests

Human Carbohydrate Sulfotransferase 1 (CHST1) ELISA Kit

Sign In for Pricing
View Details
Human Carbohydrate Sulfotransferase 1 (CHST1) ELISA Kit
YLA3471HU-02 96 Tests

Human Carbohydrate Sulfotransferase 1 (CHST1) ELISA Kit

Sign In for Pricing
View Details
C9orf57 3'UTR Lenti-reporter-Luc Vector
14810081 1.0 µg

C9orf57 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans COP9 signalosome complex subunit 3 (csn-3), partial
MBS1471877-01 0.05 mg (E-Coli)

Recombinant Caenorhabditis elegans COP9 signalosome complex subunit 3 (csn-3), partial

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans COP9 signalosome complex subunit 3 (csn-3), partial
MBS1471877-02 0.05 mg (Baculovirus)

Recombinant Caenorhabditis elegans COP9 signalosome complex subunit 3 (csn-3), partial

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans COP9 signalosome complex subunit 3 (csn-3), partial
MBS1471877-03 0.2 mg (E-Coli)

Recombinant Caenorhabditis elegans COP9 signalosome complex subunit 3 (csn-3), partial

Sign In for Pricing
View Details