Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TBX15 protein

This Human TBX15 protein spans the amino acid sequence from region 1-494aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TBX15

UniProt

Q96SF7

Expression Region

1-494aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL23 (NM_021134) Human Over-expression Lysate
LY402840 100 µg

MRPL23 (NM_021134) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human IL3RA/CD123 Protein (Fc & Avi Tag)
PKSH033800-01 20 µg

Recombinant Human IL3RA/CD123 Protein (Fc & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human IL3RA/CD123 Protein (Fc & Avi Tag)
PKSH033800-02 100 µg

Recombinant Human IL3RA/CD123 Protein (Fc & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human Interleukin-17F/IL-17F Protein
PKSH032623-01 10 µg

Recombinant Human Interleukin-17F/IL-17F Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-17F/IL-17F Protein
PKSH032623-02 50 µg

Recombinant Human Interleukin-17F/IL-17F Protein

Sign In for Pricing
View Details
SYNDIG1 Rabbit Polyclonal Antibody
ER2001-43 100 µL

SYNDIG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details