Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFB124 protein

This Human DEFB124 protein spans the amino acid sequence from region 23-71aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DEFB124

UniProt

Q8NES8

Expression Region

23-71aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin Alpha-IIb (CD41) Antibody (PE)
abx200264 100 Tests

Integrin Alpha-IIb (CD41) Antibody (PE)

Sign In for Pricing
View Details
CTAG1B (Cancer/Testis Antigen 1, Autoimmunogenic Cancer/Testis Antigen NY-ESO-1, Cancer/Testis Antigen 6.1, CT6.1, L Antigen Family Member 2, LAGE-2, CTAG1A, CTAG, CTAG1, ESO1, LAGE2, LAGE2A, LAGE2B) discontinued. See C0049-20A
149937 100 µg

CTAG1B (Cancer/Testis Antigen 1, Autoimmunogenic Cancer/Testis Antigen NY-ESO-1, Cancer/Testis Antigen 6.1, CT6.1, L Antigen Family Member 2, LAGE-2, CTAG1A, CTAG, CTAG1, ESO1, LAGE2, LAGE2A, LAGE2B) discontinued. See C0049-20A

Sign In for Pricing
View Details
MKI67 Recombinant Protein (Human)
OPCA03902-20UG 20 µg

MKI67 Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse Monoclonal C2orf43 Antibody (OTI2G9) [DyLight 488]
NBP2-72122G 0.1 mL

Mouse Monoclonal C2orf43 Antibody (OTI2G9) [DyLight 488]

Sign In for Pricing
View Details
GCLM Rabbit Polyclonal Antibody (BF680)
orb2445564 100 µL

GCLM Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
1-[2- (4-Fluoroanilino) -1,3-thiazol-5-yl]-1-ethanone
sc-302807A 5 mg

1-[2- (4-Fluoroanilino) -1,3-thiazol-5-yl]-1-ethanone

Sign In for Pricing
View Details