Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFB124 protein

This Human DEFB124 protein spans the amino acid sequence from region 23-71aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DEFB124

UniProt

Q8NES8

Expression Region

23-71aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RERE sgRNA gene knockout kit - Lentiviral human RERE sgRNA gene knockout kit (100)
GTR15384511 1 Vial

Lentiviral human RERE sgRNA gene knockout kit - Lentiviral human RERE sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human LRRC4B shRNA (UAS) - Lentiviral human LRRC4B shRNA (UAS, RFP) plasmid
GTR15320356 1 Vial

Lentiviral human LRRC4B shRNA (UAS) - Lentiviral human LRRC4B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AGAP8 (Arf-GAP with GTPase, ANK Repeat and PH Domain-Containing Protein 8, AGAP-8, Centaurin-gamma-like Family Member 5, AGAP8, CTGLF5) (MaxLight 405) discontinued
302252-ML405 100 µL

AGAP8 (Arf-GAP with GTPase, ANK Repeat and PH Domain-Containing Protein 8, AGAP-8, Centaurin-gamma-like Family Member 5, AGAP8, CTGLF5) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-UNC5CL Antibody
CTA2342-01 30 µL

Anti-UNC5CL Antibody

Sign In for Pricing
View Details
Anti-UNC5CL Antibody
CTA2342-02 50 μL

Anti-UNC5CL Antibody

Sign In for Pricing
View Details
Anti-UNC5CL Antibody
CTA2342-03 100 µL

Anti-UNC5CL Antibody

Sign In for Pricing
View Details