Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DYDC2 protein

This Human DYDC2 protein spans the amino acid sequence from region 1-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DYDC2

UniProt

Q96IM9

Expression Region

1-177aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azlocillinum Impurity 9
RM-A331009-01 10 mg

Azlocillinum Impurity 9

Sign In for Pricing
View Details
Azlocillinum Impurity 9
RM-A331009-02 25 mg

Azlocillinum Impurity 9

Sign In for Pricing
View Details
Azlocillinum Impurity 9
RM-A331009-03 50 mg

Azlocillinum Impurity 9

Sign In for Pricing
View Details
Azlocillinum Impurity 9
RM-A331009-04 100 mg

Azlocillinum Impurity 9

Sign In for Pricing
View Details
B3GALT5 (NM_033172) Human Over-expression Lysate
LC409692 20 µg

B3GALT5 (NM_033172) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal EGFR Antibody (DH8.3) [DyLight 405]
NBP2-50599V 0.1 mL

Mouse Monoclonal EGFR Antibody (DH8.3) [DyLight 405]

Sign In for Pricing
View Details