Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LSM10 protein

This Human LSM10 protein spans the amino acid sequence from region 1-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LSM10

UniProt

Q969L4

Expression Region

1-123aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stap2 3'UTR GFP Stable Cell Line
TU169804 1.0 mL

Stap2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TCN1 Antibody (C-term) Blocking Peptide
MBS9224083-01 0.5 mg

TCN1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
TCN1 Antibody (C-term) Blocking Peptide
MBS9224083-02 5x 0.5 mg

TCN1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Phospho-ATF2 (Ser322) Rabbit Polyclonal Antibody
orb4589-01 50 μL

Phospho-ATF2 (Ser322) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-ATF2 (Ser322) Rabbit Polyclonal Antibody
orb4589-02 100 µL

Phospho-ATF2 (Ser322) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-ATF2 (Ser322) Rabbit Polyclonal Antibody
orb4589-03 200 µL

Phospho-ATF2 (Ser322) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details