Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C4orf3 protein

This Human C4orf3 protein spans the amino acid sequence from region 1-44aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C4orf3

UniProt

Q8WVX3

Expression Region

1-44aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SEC22C (SEC22 homolog C, vesicle trafficking protein) Full Length
MPC3500K Each

Magic™ Membrane Protein Human SEC22C (SEC22 homolog C, vesicle trafficking protein) Full Length

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)
MBS2095486-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)
MBS2095486-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)
MBS2095486-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)
MBS2095486-04 1 mL

Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)
MBS2095486-05 5 mL

Biotin-Linked Polyclonal Antibody to Glutamate Cysteine Ligase, Catalytic (GCLC)

Sign In for Pricing
View Details