Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli CXCL10 protein

This E.coli CXCL10 protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CXCL10

UniProt

Q8MIZ1

Expression Region

22-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L210-6005, Elbow Connector, with
1216912 1 Unit

L210-6005, Elbow Connector, with

Sign In for Pricing
View Details
PLK1 3'UTR Luciferase Stable Cell Line
TU018276 1.0 mL

PLK1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DILP3 Rabbit pAb
E47R16606 100 µL

DILP3 Rabbit pAb

Sign In for Pricing
View Details
PSD2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
37899156 3x 1.0 µg DNA

PSD2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Pkd2l2-set siRNA/shRNA/RNAi Lentivector (Rat)
36873096 4x 500 ng

Pkd2l2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
HSP70-1A (HSPA1A) Rabbit Polyclonal Antibody
AP01275PU-N 100 µg

HSP70-1A (HSPA1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details