Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli CXCL10 protein

This E.coli CXCL10 protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CXCL10

UniProt

Q8MIZ1

Expression Region

22-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin PLP Antibody
orb2644756 100 µg

Myelin PLP Antibody

Sign In for Pricing
View Details
FRZB Rabbit Polyclonal Antibody
TA335006 100 µL

FRZB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human FLG2 Protein, N-His
HS774012-01 50 µg

Recombinant Human FLG2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FLG2 Protein, N-His
HS774012-02 100 µg

Recombinant Human FLG2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FLG2 Protein, N-His
HS774012-03 1 mg

Recombinant Human FLG2 Protein, N-His

Sign In for Pricing
View Details
Mmu-miR-299b-5p miRNA Antagomir
CIN1123-01 10 nmol

Mmu-miR-299b-5p miRNA Antagomir

Sign In for Pricing
View Details