Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SENP8 protein

This Human SENP8 protein spans the amino acid sequence from region 1-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SENP8

UniProt

Q96LD8

Expression Region

1-212aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSX1 rabbit pAb
RA32564-01 50 µL

GSX1 rabbit pAb

Sign In for Pricing
View Details
GSX1 rabbit pAb
RA32564-02 100 µL

GSX1 rabbit pAb

Sign In for Pricing
View Details
POU1F1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37255151 3x 1.0 µg DNA

POU1F1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Villin1 Mouse mAb
E45M22057N-100 100 µL

Villin1 Mouse mAb

Sign In for Pricing
View Details
Human JUN Protein Lysate
MBS8413831-01 0.02 mg

Human JUN Protein Lysate

Sign In for Pricing
View Details
Human JUN Protein Lysate
MBS8413831-02 5x 0.02 mg

Human JUN Protein Lysate

Sign In for Pricing
View Details