Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SENP8 protein

This Human SENP8 protein spans the amino acid sequence from region 1-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SENP8

UniProt

Q96LD8

Expression Region

1-212aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human STAU1 pAb
PA13631-01 50 μL

Rabbit Anti-Human STAU1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human STAU1 pAb
PA13631-02 100 μL

Rabbit Anti-Human STAU1 pAb

Sign In for Pricing
View Details
N-Nitroso Voglibose
RM-V071236-01 10 mg

N-Nitroso Voglibose

Sign In for Pricing
View Details
N-Nitroso Voglibose
RM-V071236-02 100 mg

N-Nitroso Voglibose

Sign In for Pricing
View Details
N-Nitroso Voglibose
RM-V071236-03 25 mg

N-Nitroso Voglibose

Sign In for Pricing
View Details
N-Nitroso Voglibose
RM-V071236-04 50 mg

N-Nitroso Voglibose

Sign In for Pricing
View Details