Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCL2L2 protein

This Human BCL2L2 protein spans the amino acid sequence from region 2-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCL2L2

UniProt

Q92843

Expression Region

2-193aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anlotinib 50mg
A16253-50 50 mg

Anlotinib 50mg

Sign In for Pricing
View Details
OTX1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11596R-BF647 100 µL

OTX1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
NPAL3 Double Nickase Plasmid (m2)
sc-428925-NIC-2 20 µg

NPAL3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Monkey Peptidyl Arginine Deiminase Type II ELISA Kit
MBS077335-01 48 Well

Monkey Peptidyl Arginine Deiminase Type II ELISA Kit

Sign In for Pricing
View Details
Monkey Peptidyl Arginine Deiminase Type II ELISA Kit
MBS077335-02 96 Well

Monkey Peptidyl Arginine Deiminase Type II ELISA Kit

Sign In for Pricing
View Details
Monkey Peptidyl Arginine Deiminase Type II ELISA Kit
MBS077335-03 5x 96 Well

Monkey Peptidyl Arginine Deiminase Type II ELISA Kit

Sign In for Pricing
View Details