Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCL2L2 protein

This Human BCL2L2 protein spans the amino acid sequence from region 2-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCL2L2

UniProt

Q92843

Expression Region

2-193aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4) B
sc-8030 B 200 µg/mL

Histone H1 (AE-4) B

Sign In for Pricing
View Details
ASD1 Protein Vector (Human) (pPB-N-His)
PV063418 500 ng

ASD1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal IgM Heavy Chain Antibody (Cocktail) [Alexa Fluor 488]
NBP3-11556AF488 0.1 mL

Mouse Monoclonal IgM Heavy Chain Antibody (Cocktail) [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit Polyclonal Frizzled-6 Antibody [Alexa Fluor 488]
NBP3-18335AF488 0.1 mL

Rabbit Polyclonal Frizzled-6 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
ACADV Polyclonal Antibody
MBS8531822-01 0.1 mg

ACADV Polyclonal Antibody

Sign In for Pricing
View Details
ACADV Polyclonal Antibody
MBS8531822-02 0.1 mL (AF635)

ACADV Polyclonal Antibody

Sign In for Pricing
View Details