Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCL2L2 protein

This Human BCL2L2 protein spans the amino acid sequence from region 2-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCL2L2

UniProt

Q92843

Expression Region

2-193aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acidic Nuclear Phosphoprotein 32 Family, Member A (ANP32A) Antibody
abx104549-01 100 µL

Acidic Nuclear Phosphoprotein 32 Family, Member A (ANP32A) Antibody

Sign In for Pricing
View Details
Acidic Nuclear Phosphoprotein 32 Family, Member A (ANP32A) Antibody
abx104549-02 200 µL

Acidic Nuclear Phosphoprotein 32 Family, Member A (ANP32A) Antibody

Sign In for Pricing
View Details
Acidic Nuclear Phosphoprotein 32 Family, Member A (ANP32A) Antibody
abx104549-03 1 mL

Acidic Nuclear Phosphoprotein 32 Family, Member A (ANP32A) Antibody

Sign In for Pricing
View Details
1,3-Dihydro-1- (4-fluorophenyl) -2H-imidazole-2-thione
sc-255922 5 g

1,3-Dihydro-1- (4-fluorophenyl) -2H-imidazole-2-thione

Sign In for Pricing
View Details
Human C14orf119 siRNA
abx909515-01 15 nmol

Human C14orf119 siRNA

Sign In for Pricing
View Details
Human C14orf119 siRNA
abx909515-02 30 nmol

Human C14orf119 siRNA

Sign In for Pricing
View Details