Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTPMT1 protein

This Human PTPMT1 protein spans the amino acid sequence from region 28-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTPMT1

UniProt

Q8WUK0

Expression Region

28-201aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTRN Protein Vector (Rat) (pPB-N-His)
PV314943 500 ng

UTRN Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
SUMO3 monoclonal antibody
orb1677125-01 50 µL

SUMO3 monoclonal antibody

Sign In for Pricing
View Details
SUMO3 monoclonal antibody
orb1677125-02 100 µL

SUMO3 monoclonal antibody

Sign In for Pricing
View Details
SUMO3 monoclonal antibody
orb1677125-03 200 µL

SUMO3 monoclonal antibody

Sign In for Pricing
View Details
Mouse CYTH1 (Cytohesin 1) ELISA Kit
MBS2514892-01 24 Tests

Mouse CYTH1 (Cytohesin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse CYTH1 (Cytohesin 1) ELISA Kit
MBS2514892-02 48 Test

Mouse CYTH1 (Cytohesin 1) ELISA Kit

Sign In for Pricing
View Details