Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DCP2 protein

This Human DCP2 protein spans the amino acid sequence from region 1-385aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DCP2

UniProt

Q8IU60

Expression Region

1-385aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP55 Rabbit Polyclonal Antibody (PE-Cy5)
orb869560 100 µL

CEP55 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Anti-CD63 Rabbit pAb
GB115694-100 100 μL

Anti-CD63 Rabbit pAb

Sign In for Pricing
View Details
mmu-miR-6369 miRNA Inhibitor
MIM02371 2x 5.0 nmol

mmu-miR-6369 miRNA Inhibitor

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)
MBS2048038-01 0.1 mL

APC-Linked Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)
MBS2048038-02 0.2 mL

APC-Linked Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)
MBS2048038-03 0.5 mL

APC-Linked Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details