Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DCP2 protein

This Human DCP2 protein spans the amino acid sequence from region 1-385aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DCP2

UniProt

Q8IU60

Expression Region

1-385aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Human BID (BH3 Interacting Domain Death Agonist)
E-EL-H0577 96 Tests

ELISA kit for Human BID (BH3 Interacting Domain Death Agonist)

Sign In for Pricing
View Details
DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued
369868-01 48 Tests

DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued
369868-02 96 Tests

DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Dhodh ORF Vector (Rat) (pORF)
ORF065993 1.0 µg DNA

Dhodh ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ATG3 Peptide
AF7587-BP 1 mg

ATG3 Peptide

Sign In for Pricing
View Details
OsM3K-E16 Antibody
MBS859630-01 0.1 mg

OsM3K-E16 Antibody

Sign In for Pricing
View Details