Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Kcne2 protein

This Rat Kcne2 protein spans the amino acid sequence from region 1-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kcne2

UniProt

P63161

Expression Region

1-123aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-123aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6824 Human qPCR Template Standard (MI0022669)
HK301425 200 Reactions

MIR6824 Human qPCR Template Standard (MI0022669)

Sign In for Pricing
View Details
TIC56 Antibody
PHY5685S 150 μg

TIC56 Antibody

Sign In for Pricing
View Details
Human p130Cas Recombinant Protein
PROTP56945-250ug 250 µg

Human p130Cas Recombinant Protein

Sign In for Pricing
View Details
Group A Streptococcus Antibody (biotin)
35-196 1 mL

Group A Streptococcus Antibody (biotin)

Sign In for Pricing
View Details
RABEPK Recombinant Antbody Kit (KD-Validated)
bsm-90477R-01 50 µL

RABEPK Recombinant Antbody Kit (KD-Validated)

Sign In for Pricing
View Details
RABEPK Recombinant Antbody Kit (KD-Validated)
bsm-90477R-02 50μL Ab + 25μg cell Lysate + 25μg WT cell

RABEPK Recombinant Antbody Kit (KD-Validated)

Sign In for Pricing
View Details