E.coli FXN protein
This E.coli FXN protein spans the amino acid sequence from region 81-210aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
FXN
UniProt
Q8HXX9
Expression Region
81-210aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Infectious Disease & Virology; Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8114702-01 0.3 mg
Influenza A H11N2 (A/duck/Yangzhou/906/2002) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
Sign In for Pricing
View Details MBS8114702-02 5x 0.3 mg
Influenza A H11N2 (A/duck/Yangzhou/906/2002) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
Sign In for Pricing
View Details 
128419-ML750 100 µL
IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Interleukin-18 Receptor Accessory Protein-like, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, CD218b, IL1R7, MGC120589, MGC120590) (MaxLight 750) discontinued
Sign In for Pricing
View Details