Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli FXN protein

This E.coli FXN protein spans the amino acid sequence from region 81-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FXN

UniProt

Q8HXX9

Expression Region

81-210aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX3 (Sorting Nexin 3, Grd19, MCOPS8, MGC17570, SDP3, SNX3A) (MaxLight 490)
251944-ML490 100 µL

SNX3 (Sorting Nexin 3, Grd19, MCOPS8, MGC17570, SDP3, SNX3A) (MaxLight 490)

Sign In for Pricing
View Details
POLK (Polymerase (DNA Directed) kappa, DINB1, DINP) (MaxLight 650)
250288-ML650 100 µL

POLK (Polymerase (DNA Directed) kappa, DINB1, DINP) (MaxLight 650)

Sign In for Pricing
View Details
IRF1 Rabbit mAb
MBS9469728-01 0.05 mL

IRF1 Rabbit mAb

Sign In for Pricing
View Details
IRF1 Rabbit mAb
MBS9469728-02 0.1 mL

IRF1 Rabbit mAb

Sign In for Pricing
View Details
IRF1 Rabbit mAb
MBS9469728-03 5x 0.1 mL

IRF1 Rabbit mAb

Sign In for Pricing
View Details
IRS2 Protein Vector (Rat) (pPM-C-HA)
PV275028 500 ng

IRS2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details