Human JAM2 protein
This Human JAM2 protein spans the amino acid sequence from region 29-238aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
JAM2 C21orf43 VEJAM UNQ219, PRO245
UniProt
P57087
Expression Region
29-238aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular domain of His-tag and expression region is 29-238aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682026-100 1x 100 µL
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473128-500 1x 500 µL
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB1908-500 1x 500 µL
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), 0.2mg/mL
Sign In for Pricing
View Details 
BNC681628-100 1x 100 µL
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB1526-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), 0.2mg/mL
Sign In for Pricing
View Details