Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human JAK2 protein

This Human JAK2 protein spans the amino acid sequence from region 752-1132aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

JAK2

UniProt

O60674

Expression Region

752-1132aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-1132aa of His-tag and expression region is 752-1132aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PER-3 Recombinant Antibody, Cy7 Conjugated
bsm-62297R-Cy7 100 µL

PER-3 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ALX4 Rabbit Polyclonal Antibody
E10G06363 100 µL

ALX4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Gremlin 2 (GREM2)
TRV-0048807-01 10 µg

Recombinant Gremlin 2 (GREM2)

Sign In for Pricing
View Details
Recombinant Gremlin 2 (GREM2)
TRV-0048807-02 50 µg

Recombinant Gremlin 2 (GREM2)

Sign In for Pricing
View Details
Recombinant Gremlin 2 (GREM2)
TRV-0048807-03 100 µg

Recombinant Gremlin 2 (GREM2)

Sign In for Pricing
View Details
Recombinant Gremlin 2 (GREM2)
TRV-0048807-04 200 µg

Recombinant Gremlin 2 (GREM2)

Sign In for Pricing
View Details