Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifne protein

This Mouse Ifne protein spans the amino acid sequence from region 22-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ifne

UniProt

Q80ZF2

Expression Region

22-192aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slbp shRNA (UAS) - Lentiviral mouse Slbp shRNA (UAS, iRFP) (100)
GTR15272859 1 Vial

Lentiviral mouse Slbp shRNA (UAS) - Lentiviral mouse Slbp shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Anti Human CCNA2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120ul
IRBAHUCCNA2AP398120UL 120 µL

Rabbit Anti Human CCNA2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120ul

Sign In for Pricing
View Details
Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)
RM-F051612-01 10 mg

Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)

Sign In for Pricing
View Details
Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)
RM-F051612-02 25 mg

Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)

Sign In for Pricing
View Details
Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)
RM-F051612-03 50 mg

Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)

Sign In for Pricing
View Details
Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)
RM-F051612-04 100 mg

Fenoterol Impurity 2; Fenoterol Hydrobromide EP Impurity C (S, S-Isomer)

Sign In for Pricing
View Details