Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

Recombinant human Valacyclovir hydrolase

Product Specifications

Product Name Alternative

BPHL

UniProt

Q86WA6

Expression Region

1-274aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSL24D1 Protein Vector (Human) (pPM-C-HA)
PV036419 500 ng

RSL24D1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DCTN2, ID (DCTN2, DCTN50, Dynactin subunit 2, 50kD dynein-associated polypeptide, Dynactin complex 50kD subunit, p50 dynamitin) (APC) discontinued
034520-APC 200 µL

DCTN2, ID (DCTN2, DCTN50, Dynactin subunit 2, 50kD dynein-associated polypeptide, Dynactin complex 50kD subunit, p50 dynamitin) (APC) discontinued

Sign In for Pricing
View Details
Flt3 (Phospho Tyr599) Polyclonal Antibody
MBS9459031-01 0.05 mL

Flt3 (Phospho Tyr599) Polyclonal Antibody

Sign In for Pricing
View Details
Flt3 (Phospho Tyr599) Polyclonal Antibody
MBS9459031-02 0.1 mL

Flt3 (Phospho Tyr599) Polyclonal Antibody

Sign In for Pricing
View Details
Flt3 (Phospho Tyr599) Polyclonal Antibody
MBS9459031-03 5x 0.1 mL

Flt3 (Phospho Tyr599) Polyclonal Antibody

Sign In for Pricing
View Details
ATF1 Rabbit Polyclonal Antibody
orb573769 100 µL

ATF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details