Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

Recombinant human Valacyclovir hydrolase

Product Specifications

Product Name Alternative

BPHL

UniProt

Q86WA6

Expression Region

1-274aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERG Rabbit Polyclonal Antibody (Carrier-free)
orb3116806 100 µg

ERG Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
4-Aminobenzoic Acid 99% Extrapure
02901 00500 500 g

4-Aminobenzoic Acid 99% Extrapure

Sign In for Pricing
View Details
DLL4 Antibody
E45R33634G-1 100 µL

DLL4 Antibody

Sign In for Pricing
View Details
Lentiviral human RDH14 shRNA (UAS) - Lentiviral human RDH14 shRNA (UAS, iRFP) plasmid
GTR15080932 1 Vial

Lentiviral human RDH14 shRNA (UAS) - Lentiviral human RDH14 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human LY6G6D Protein, hFc Tag
orb3145483-01 10 µg

Human LY6G6D Protein, hFc Tag

Sign In for Pricing
View Details
Human LY6G6D Protein, hFc Tag
orb3145483-02 50 µg

Human LY6G6D Protein, hFc Tag

Sign In for Pricing
View Details