Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

Recombinant human Valacyclovir hydrolase

Product Specifications

Product Name Alternative

BPHL

UniProt

Q86WA6

Expression Region

1-274aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBF1 (SREBP1, SREBP-1c, BHLHD1, Sterol Regulatory Element-Binding Protein 1, Class D Basic Helix-Loop-Helix Protein 1, SREBP-1)
352554 100 µg

SREBF1 (SREBP1, SREBP-1c, BHLHD1, Sterol Regulatory Element-Binding Protein 1, Class D Basic Helix-Loop-Helix Protein 1, SREBP-1)

Sign In for Pricing
View Details
Hi-PCR® Milk Cow Probe PCR Kit
MBPCR236-50R 50 Reaction

Hi-PCR® Milk Cow Probe PCR Kit

Sign In for Pricing
View Details
NUTM2F Antibody - C-terminal region
ARP70224_P050-25UL 25 µL

NUTM2F Antibody - C-terminal region

Sign In for Pricing
View Details
Ecsit (NM_001006986) Rat Tagged ORF Clone
RR209134 10 µg

Ecsit (NM_001006986) Rat Tagged ORF Clone

Sign In for Pricing
View Details
HENMT1 Antibody Blocking Peptide
orb1511574 500 µg

HENMT1 Antibody Blocking Peptide

Sign In for Pricing
View Details
ISO20560PM-85X500-DIESEL Pipe Markers for Other Liquids
317113 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-85X500-DIESEL Pipe Markers for Other Liquids

Sign In for Pricing
View Details