Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog IL8 protein

This Dog IL8 protein spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein

UniProt

P41324

Expression Region

23-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 23-101aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Accuris qMAX Probe One-Step RT-qPCR Kit, No Rox, sample 20 reactions
PR2121-N-S 1 Each

Accuris qMAX Probe One-Step RT-qPCR Kit, No Rox, sample 20 reactions

Sign In for Pricing
View Details
CTRP6 (C1QTNF6) (NM_031910) Human Over-expression Lysate
LY403130 100 µg

CTRP6 (C1QTNF6) (NM_031910) Human Over-expression Lysate

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF488A conjugate, 0.1mg/mL
BNC881761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCCD1 (NM_001011700) Human Recombinant Protein
TP319552M 100 µg

MCCD1 (NM_001011700) Human Recombinant Protein

Sign In for Pricing
View Details
Rhob Mouse Gene Knockout Kit (CRISPR)
KN514764 1 Kit

Rhob Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLPP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA502061BM 100 µL

CLPP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details