Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LYPD6 protein

This Human LYPD6 protein spans the amino acid sequence from region 23-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LYPD6

UniProt

Q86Y78

Expression Region

23-171aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICA1 antibody
FNab10838 100 µg

ICA1 antibody

Sign In for Pricing
View Details
Lentiviral mouse Gdf6 shRNA (UAS) - Lentiviral mouse Gdf6 shRNA (UAS, GFP) plasmid
GTR15300829 1 Vial

Lentiviral mouse Gdf6 shRNA (UAS) - Lentiviral mouse Gdf6 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
N- (5-Bromopyrimidin-2-yl) -N- (methoxymethyl) methanesulfonamide
457294-01 100 mg

N- (5-Bromopyrimidin-2-yl) -N- (methoxymethyl) methanesulfonamide

Sign In for Pricing
View Details
N- (5-Bromopyrimidin-2-yl) -N- (methoxymethyl) methanesulfonamide
457294-02 250 mg

N- (5-Bromopyrimidin-2-yl) -N- (methoxymethyl) methanesulfonamide

Sign In for Pricing
View Details
MEF2D Antibody
orb380123 100 µL

MEF2D Antibody

Sign In for Pricing
View Details
SPAG11B (Sperm-Associated Antigen 11B)
492609 100 µL

SPAG11B (Sperm-Associated Antigen 11B)

Sign In for Pricing
View Details