Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Defb14 protein

This Mouse Defb14 protein spans the amino acid sequence from region 23-67aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defb14

UniProt

Q7TNV9

Expression Region

23-67aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAT3 Rabbit Polyclonal Antibody
JOT-AP02633-01 20 µL

FAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAT3 Rabbit Polyclonal Antibody
JOT-AP02633-02 50 μL

FAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAT3 Rabbit Polyclonal Antibody
JOT-AP02633-03 100 µL

FAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PSTPIP1 Antibody Picoband® (Dylight488 Conjugate)
A04844-1-Dylight488 100 µg

Anti-PSTPIP1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Psc Antibody
orb806982 2 mg

Psc Antibody

Sign In for Pricing
View Details
2'-Deoxyguanosine monohydrate-13C5
HY-W768213 1 Each

2'-Deoxyguanosine monohydrate-13C5

Sign In for Pricing
View Details