Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL12B protein

This Sheep IL12B protein spans the amino acid sequence from region 23-327aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL12B

UniProt

P68220

Expression Region

23-327aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 23-327aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCHKDANIRVQARDRYYSSFWSEWASVSCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF2 Protein Vector (Mouse) (pPM-C-His)
PV194525 500 ng

KLF2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Short Chain Enoyl-CoA Hydratase, SCEH, Enoyl-CoA Hydratase 1) (APC)
126146-APC 100 µL

ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Short Chain Enoyl-CoA Hydratase, SCEH, Enoyl-CoA Hydratase 1) (APC)

Sign In for Pricing
View Details
SERPINA5, NT (SERPINA5, PCI, PLANH3, PROCI, Plasma serine protease inhibitor, Acrosomal serine protease inhibitor, Plasminogen activator inhibitor 3, Protein C inhibitor, Serpin A5)
041575 200 µL

SERPINA5, NT (SERPINA5, PCI, PLANH3, PROCI, Plasma serine protease inhibitor, Acrosomal serine protease inhibitor, Plasminogen activator inhibitor 3, Protein C inhibitor, Serpin A5)

Sign In for Pricing
View Details
HNF1A (Hepatocyte Nuclear Factor 1-Alpha, HNF1 Homeobox A)
482865 100 µL

HNF1A (Hepatocyte Nuclear Factor 1-Alpha, HNF1 Homeobox A)

Sign In for Pricing
View Details
Mesothelin Antibody
V7654-100UG 100 µg

Mesothelin Antibody

Sign In for Pricing
View Details
IKBKB AAV siRNA Pooled Vector
24797161 1.0 µg

IKBKB AAV siRNA Pooled Vector

Sign In for Pricing
View Details