Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCBL protein

This Human CCBL protein spans the amino acid sequence from region 1-454aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCBL

UniProt

Q6YP21

Expression Region

1-454aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cadherin-6 (CDH6) ELISA Kit
RK12705 96 Tests

Mouse Cadherin-6 (CDH6) ELISA Kit

Sign In for Pricing
View Details
MTRNR2L6 siRNA (Human)
MBS8238896-01 15 nmol

MTRNR2L6 siRNA (Human)

Sign In for Pricing
View Details
MTRNR2L6 siRNA (Human)
MBS8238896-02 30 nmol

MTRNR2L6 siRNA (Human)

Sign In for Pricing
View Details
MTRNR2L6 siRNA (Human)
MBS8238896-03 5x 30 nmol

MTRNR2L6 siRNA (Human)

Sign In for Pricing
View Details
Dydc1 (BC049632) Mouse Tagged ORF Clone
MG201215 10 µg

Dydc1 (BC049632) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SOX15 (SRY (Sex Determining Region Y) -Box 15, SOX20, SOX26, SOX27) (AP) discontinued
251975-AP 100 µL

SOX15 (SRY (Sex Determining Region Y) -Box 15, SOX20, SOX26, SOX27) (AP) discontinued

Sign In for Pricing
View Details