Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Arachin Ahy-3 protein

This E.coli Arachin Ahy-3 protein spans the amino acid sequence from region 299-478aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arachin Ahy-3 [Cleaved into, Arachin Ahy-3 chain alpha, Arachin Ahy-3 chain beta]

UniProt

Q647H2

Expression Region

299-478aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Arachis hypogaea (Peanut)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCA1 (E-4) AC
sc-271156 AC 500 µg/mL - 25% ag

CLCA1 (E-4) AC

Sign In for Pricing
View Details
DOC2A (Center) Rabbit pAb
MBS8551836-01 0.1 mL

DOC2A (Center) Rabbit pAb

Sign In for Pricing
View Details
DOC2A (Center) Rabbit pAb
MBS8551836-02 0.1 mL (AF405L)

DOC2A (Center) Rabbit pAb

Sign In for Pricing
View Details
DOC2A (Center) Rabbit pAb
MBS8551836-03 0.1 mL (AF405S)

DOC2A (Center) Rabbit pAb

Sign In for Pricing
View Details
DOC2A (Center) Rabbit pAb
MBS8551836-04 0.1 mL (AF610)

DOC2A (Center) Rabbit pAb

Sign In for Pricing
View Details
DOC2A (Center) Rabbit pAb
MBS8551836-05 0.1 mL (AF635)

DOC2A (Center) Rabbit pAb

Sign In for Pricing
View Details