What is the catalog number for E.coli Arachin Ahy-3 protein?

The catalog number for E.coli Arachin Ahy-3 protein is orb244858.

What sizes are available for E.coli Arachin Ahy-3 protein?

E.coli Arachin Ahy-3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E.coli Arachin Ahy-3 protein come in?

E.coli Arachin Ahy-3 protein is available in 3 different pack sizes.

Is E.coli Arachin Ahy-3 protein in stock?

E.coli Arachin Ahy-3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

E.coli Arachin Ahy-3 protein

This E.coli Arachin Ahy-3 protein spans the amino acid sequence from region 299-478aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arachin Ahy-3 [Cleaved into, Arachin Ahy-3 chain alpha, Arachin Ahy-3 chain beta]

UniProt

Q647H2

Expression Region

299-478aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Arachis hypogaea (Peanut)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ