Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BEND3 protein

This Human BEND3 protein spans the amino acid sequence from region 328-461aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEND3

UniProt

Q5T5X7

Expression Region

328-461aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6ST (Interleukin 6 Signal Transducer (gp130, Oncostatin M Receptor), CD130, CDw130, GP130, GP130-RAPS, IL6R-beta) (PE)
MBS6183668-01 0.1 mL

IL6ST (Interleukin 6 Signal Transducer (gp130, Oncostatin M Receptor), CD130, CDw130, GP130, GP130-RAPS, IL6R-beta) (PE)

Sign In for Pricing
View Details
IL6ST (Interleukin 6 Signal Transducer (gp130, Oncostatin M Receptor), CD130, CDw130, GP130, GP130-RAPS, IL6R-beta) (PE)
MBS6183668-02 5x 0.1 mL

IL6ST (Interleukin 6 Signal Transducer (gp130, Oncostatin M Receptor), CD130, CDw130, GP130, GP130-RAPS, IL6R-beta) (PE)

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida plsX Protein
VAng-Lsx1385-50gEcoli 50 µg (E. coli)

Recombinant Aeromonas Salmonicida plsX Protein

Sign In for Pricing
View Details
Mouse Monoclonal Borrelia Burgdorferi Flagellar Antigen Antibody (7G11/6802) [Alexa Fluor 647]
NB110-59982AF647 0.1 mL

Mouse Monoclonal Borrelia Burgdorferi Flagellar Antigen Antibody (7G11/6802) [Alexa Fluor 647]

Sign In for Pricing
View Details
hsa-miR-6835-5p miRNA Antagomir
MNH03632 2x 5.0 nmol

hsa-miR-6835-5p miRNA Antagomir

Sign In for Pricing
View Details
Benzyl 2- (3-oxocyclobutyl) acetate
MJB30721-01 50 mg

Benzyl 2- (3-oxocyclobutyl) acetate

Sign In for Pricing
View Details