Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA21 protein

This Human IFNA21 protein spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNA21

UniProt

P01568

Expression Region

24-189aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 24-189aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF3 Human Gene Knockout Kit (CRISPR)
KN415000 1 Kit

BATF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS640171 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
CD13 Antibody
KC-7507-01 50 μL

CD13 Antibody

Sign In for Pricing
View Details
CD13 Antibody
KC-7507-02 100 µL

CD13 Antibody

Sign In for Pricing
View Details
CD13 Antibody
KC-7507-03 1 mL

CD13 Antibody

Sign In for Pricing
View Details
TOP2A (Ab-1343) Antibody
8B8221-AAT 50 µg

TOP2A (Ab-1343) Antibody

Sign In for Pricing
View Details