Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TBCEL protein

This Human TBCEL protein spans the amino acid sequence from region 1-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TBCEL

UniProt

Q5QJ74

Expression Region

1-424aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK4 (G-Protein Coupled Receptor Kinase 4, G-Protein-coupled Receptor Kinase GRK4, GPRK4, GRK4a, GPRK2L, ITI1) (FITC)
MBS6147470-01 0.1 mL

GRK4 (G-Protein Coupled Receptor Kinase 4, G-Protein-coupled Receptor Kinase GRK4, GPRK4, GRK4a, GPRK2L, ITI1) (FITC)

Sign In for Pricing
View Details
GRK4 (G-Protein Coupled Receptor Kinase 4, G-Protein-coupled Receptor Kinase GRK4, GPRK4, GRK4a, GPRK2L, ITI1) (FITC)
MBS6147470-02 5x 0.1 mL

GRK4 (G-Protein Coupled Receptor Kinase 4, G-Protein-coupled Receptor Kinase GRK4, GPRK4, GRK4a, GPRK2L, ITI1) (FITC)

Sign In for Pricing
View Details
MUC16 Recombinant Rabbit Monoclonal Antibody [SN0715]
ET1611-73 100 µL

MUC16 Recombinant Rabbit Monoclonal Antibody [SN0715]

Sign In for Pricing
View Details
Olfr804 Recombinant Protein (Mouse)
RP158795 100 µg

Olfr804 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 12 Antibody
NBP3-33197-20ul 20 µL

Rabbit Monoclonal Cytokeratin 12 Antibody

Sign In for Pricing
View Details
Olfr1166 (NM_146650) Mouse Tagged Lenti ORF Clone
MR204532L4 10 µg

Olfr1166 (NM_146650) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details