Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TBCEL protein

This Human TBCEL protein spans the amino acid sequence from region 1-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TBCEL

UniProt

Q5QJ74

Expression Region

1-424aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC302228 3'UTR Luciferase Stable Cell Line
TU209909 1.0 mL

LOC302228 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
6'-O-Sulfated Lewis X
OS58479-01 1 mg

6'-O-Sulfated Lewis X

Sign In for Pricing
View Details
6'-O-Sulfated Lewis X
OS58479-02 2 mg

6'-O-Sulfated Lewis X

Sign In for Pricing
View Details
6'-O-Sulfated Lewis X
OS58479-03 5 mg

6'-O-Sulfated Lewis X

Sign In for Pricing
View Details
XAGE2 Recombinant Protein (Human)
RP034891 100 µg

XAGE2 Recombinant Protein (Human)

Sign In for Pricing
View Details
BRCA1 Rabbit Polyclonal Antibody (BF594)
orb2556229 100 µL

BRCA1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details