Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ID2 protein

This Human ID2 protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ID2

UniProt

Q02363

Expression Region

1-134aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-134aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFN2 Rabbit Polyclonal Antibody (FITC)
orb2122212 100 µL

MFN2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Fixation and Permeabilization Flow Cytometry Kit
NBP2-31377 2 Vials

Fixation and Permeabilization Flow Cytometry Kit

Sign In for Pricing
View Details
L-796,778 acetate
T32511L-01 1 mg

L-796,778 acetate

Sign In for Pricing
View Details
L-796,778 acetate
T32511L-02 5 mg

L-796,778 acetate

Sign In for Pricing
View Details
L-796,778 acetate
T32511L-03 10 mg

L-796,778 acetate

Sign In for Pricing
View Details
L-796,778 acetate
T32511L-04 25 mg

L-796,778 acetate

Sign In for Pricing
View Details