Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ID2 protein

This Human ID2 protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ID2

UniProt

Q02363

Expression Region

1-134aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-134aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbed4 sgRNA CRISPR Lentivector set (Mouse)
K4626901 3x 1.0 µg

Zbed4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Knqdk peptide
orb1983708-01 100 mg

Knqdk peptide

Sign In for Pricing
View Details
Knqdk peptide
orb1983708-02 500 mg

Knqdk peptide

Sign In for Pricing
View Details
4930451C15Rik Protein Vector (Mouse) (pPM-C-His)
PV149149 500 ng

4930451C15Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal CHCHD8 Antibody
NBP2-82672-0.1mL 0.1 mL

Rabbit Polyclonal CHCHD8 Antibody

Sign In for Pricing
View Details
WDFY1 Protein Vector (Mouse) (pPM-C-HA)
PV246908 500 ng

WDFY1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details