Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ID2 protein

This Human ID2 protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ID2

UniProt

Q02363

Expression Region

1-134aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-134aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nesprin 1 Rabbit mAb
E45R11742N 50 ul

Nesprin 1 Rabbit mAb

Sign In for Pricing
View Details
Protein-cysteine N-palmitoyltransferase HHAT (HHAT) Mouse ELISA Kit
G4569 96 Tests

Protein-cysteine N-palmitoyltransferase HHAT (HHAT) Mouse ELISA Kit

Sign In for Pricing
View Details
Ether Petroleum 400-600C AR
113200500 500 mL

Ether Petroleum 400-600C AR

Sign In for Pricing
View Details
Zbtb17 Mouse qPCR Primer Pair (NM_009541)
MP218675 200 Reactions

Zbtb17 Mouse qPCR Primer Pair (NM_009541)

Sign In for Pricing
View Details
pCMV-SPORT6.ccdb-Rcn2-r Plasmid
PVT20781 2 µg

pCMV-SPORT6.ccdb-Rcn2-r Plasmid

Sign In for Pricing
View Details
IGF2BP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G7]
TA501272AM 100 µL

IGF2BP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G7]

Sign In for Pricing
View Details