Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ID2 protein

This Human ID2 protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ID2

UniProt

Q02363

Expression Region

1-134aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-134aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HORMAD1 Lentiviral Activation Particles (m)
sc-426861-LAC 200 µL

HORMAD1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Factor IX Recombinant Antibody, Biotin Conjugated
bsm-61668R-Biotin-TR 20 µL

Factor IX Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
EPDR1 Polyclonal Antibody, PerCP Conjugated
bs-5837R-PerCP 100 µL

EPDR1 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Thiocarlide
MBS5798816 Inquire

Thiocarlide

Sign In for Pricing
View Details
CASK/LIN-2 (MaxLight 750) discontinued
C1035-24-ML750 100 µL

CASK/LIN-2 (MaxLight 750) discontinued

Sign In for Pricing
View Details
2010107E04Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4760103 1.0 µg DNA

2010107E04Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details