Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ICA1 protein

This Human ICA1 protein spans the amino acid sequence from region 1-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ICA1

UniProt

Q05084

Expression Region

1-268aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-483aa of His-tag and expression region is 1-268aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK1 Recombinant Protein (Mouse)
RP129257 100 µg

DLK1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mouse Terminal Complement Complex C5b-9 (TCC C5b-9) ELISA Kit
orb2812466-01 48 Tests

Mouse Terminal Complement Complex C5b-9 (TCC C5b-9) ELISA Kit

Sign In for Pricing
View Details
Mouse Terminal Complement Complex C5b-9 (TCC C5b-9) ELISA Kit
orb2812466-02 96 Tests

Mouse Terminal Complement Complex C5b-9 (TCC C5b-9) ELISA Kit

Sign In for Pricing
View Details
Mouse Terminal Complement Complex C5b-9 (TCC C5b-9) ELISA Kit
orb2812466-03 5 x 96 T

Mouse Terminal Complement Complex C5b-9 (TCC C5b-9) ELISA Kit

Sign In for Pricing
View Details
Orforglipron ELISA Kit
KPTX468 1 Kit

Orforglipron ELISA Kit

Sign In for Pricing
View Details
ZHX3 Protein Vector (Human) (pPM-C-His)
PV047260 500 ng

ZHX3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details