Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HSD11B1 protein

This Human HSD11B1 protein spans the amino acid sequence from region 25-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSD11B1

UniProt

P28845

Expression Region

25-292aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 25-292aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit
MBS9930825-01 48 Well

Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit

Sign In for Pricing
View Details
Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit
MBS9930825-02 96 Well

Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit

Sign In for Pricing
View Details
Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit
MBS9930825-03 5x 96 Well

Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit

Sign In for Pricing
View Details
Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit
MBS9930825-04 10x 96 Well

Horse Proteasome Subunit Beta Type-10 (PSMB10) ELISA Kit

Sign In for Pricing
View Details
rno-miR-23a-3p miRNA Antagomir
MBS8320496-01 10 nmol

rno-miR-23a-3p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-23a-3p miRNA Antagomir
MBS8320496-02 20 nmol

rno-miR-23a-3p miRNA Antagomir

Sign In for Pricing
View Details