Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd163 protein

This Mouse Cd163 protein spans the amino acid sequence from region 86-365aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd163

UniProt

Q2VLH6

Expression Region

86-365aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O157:H7 RBSD Polyclonal Antibody
MBS9005644 Inquire

Rabbit anti-Escherichia coli O157:H7 RBSD Polyclonal Antibody

Sign In for Pricing
View Details
FAIM 3'UTR Luciferase Stable Cell Line
TU007216 1.0 mL

FAIM 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monoclonal anti-human CD133 (AC133)/FITC
MBS666952-01 120 Tests

Monoclonal anti-human CD133 (AC133)/FITC

Sign In for Pricing
View Details
Monoclonal anti-human CD133 (AC133)/FITC
MBS666952-02 5x 120 Tests

Monoclonal anti-human CD133 (AC133)/FITC

Sign In for Pricing
View Details
(±) -PD 128907 Hydrochloride (Dopamine D3 Receptor Agonist, PD 128,907, PD 128907, PD128907) discontinued. see 462091
217625 5 mg

(±) -PD 128907 Hydrochloride (Dopamine D3 Receptor Agonist, PD 128,907, PD 128907, PD128907) discontinued. see 462091

Sign In for Pricing
View Details
Rabbit anti-SAP61 Antibody
MBS4508183-01 0.05 mL

Rabbit anti-SAP61 Antibody

Sign In for Pricing
View Details