Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine LAP3 protein

This Bovine LAP3 protein spans the amino acid sequence from region 25-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAP3

UniProt

P00727

Expression Region

25-64aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRAF2 sgRNA gene knockout kit - Lentiviral human PRAF2 sgRNA gene knockout kit (plasmid)
GTR15373856 1 Vial

Lentiviral human PRAF2 sgRNA gene knockout kit - Lentiviral human PRAF2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rat Gastrin cell antibody ELISA Kit
MBS722521-01 48 Well

Rat Gastrin cell antibody ELISA Kit

Sign In for Pricing
View Details
Rat Gastrin cell antibody ELISA Kit
MBS722521-02 96 Well

Rat Gastrin cell antibody ELISA Kit

Sign In for Pricing
View Details
Rat Gastrin cell antibody ELISA Kit
MBS722521-03 5x 96 Well

Rat Gastrin cell antibody ELISA Kit

Sign In for Pricing
View Details
Rat Gastrin cell antibody ELISA Kit
MBS722521-04 10x 96 Well

Rat Gastrin cell antibody ELISA Kit

Sign In for Pricing
View Details
PTPRC Antibody
OAEE00254-100UG 0.1 mg (C100)

PTPRC Antibody

Sign In for Pricing
View Details